PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570954.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25766.4 Da    PI: 9.6751
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570954.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.6e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  XP_012570954.1  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                    79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006634.118161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-42160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-33279IPR002100Transcription factor, MADS-box
CDDcd002655.37E-44276No hitNo description
PRINTSPR004045.0E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-2684171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.40487177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
NIRSTIDRYK KACSDHSSTS TTTEINAQYY QQESAKLRQQ IQMLQNSNRH LMGDALSTLT  120
VKELKQLENR LERGITRIRS KKHEMLLAEI EYFQKREIEL ENENLCLRSK INDVERLPQV  180
NMVSGQELNA IQALASRNFF NPNMMEDGTS YPQSDKKILH LG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-22182182Myocyte-specific enhancer factor 2B
1tqe_Q2e-22182182Myocyte-specific enhancer factor 2B
1tqe_R2e-22182182Myocyte-specific enhancer factor 2B
1tqe_S2e-22182182Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3718990.0DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004499566.11e-164PREDICTED: agamous-like MADS-box protein AGL11
RefseqXP_004499567.11e-164PREDICTED: agamous-like MADS-box protein AGL11
RefseqXP_012570954.11e-164PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ388361e-118AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLB9MSS81e-155B9MSS8_SOYBN; MADS domain transporter AGL11
STRINGGLYMA06G48270.21e-154(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-120MIKC_MADS family protein